Lineage for d1y7zb_ (1y7z B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. Protein Hemoglobin, beta-chain [46500] (26 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [46501] (287 PDB entries)
    Uniprot P68871
  8. Domain d1y7zb_: 1y7z B: [116549]
    Other proteins in same PDB: d1y7za_, d1y7zc_
    complexed with hem

Details for d1y7zb_

PDB Entry: 1y7z (more details), 1.98 Å

PDB Description: T-To-T(High) quaternary transitions in human hemoglobin: betaN108A deoxy low-salt (1 test set)
PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d1y7zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7zb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgavlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d1y7zb_ are not available.

Timeline for d1y7zb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1y7za_, d1y7zc_, d1y7zd_