Lineage for d1y7ia_ (1y7i A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1870341Family c.69.1.20: Hydroxynitrile lyase-like [53585] (3 proteins)
    automatically mapped to Pfam PF12697
  6. 1870390Protein Salicylic acid-binding protein 2 (SABP2) [117707] (1 species)
  7. 1870391Species Tobacco (Nicotiana tabacum) [TaxId:4097] [117708] (3 PDB entries)
    Uniprot Q6RYA0
  8. 1870396Domain d1y7ia_: 1y7i A: [116546]
    Structural genomics target
    complexed with sal

Details for d1y7ia_

PDB Entry: 1y7i (more details), 2.1 Å

PDB Description: Structural and biochemical studies identify tobacco SABP2 as a methylsalicylate esterase and further implicate it in plant innate immunity, Northeast Structural Genomics Target AR2241
PDB Compounds: (A:) salicylic acid-binding protein 2

SCOPe Domain Sequences for d1y7ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7ia_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
egkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlpl
melmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleqy
nertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpsslf
medlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmaml
cepqklcaslleiahkyn

SCOPe Domain Coordinates for d1y7ia_:

Click to download the PDB-style file with coordinates for d1y7ia_.
(The format of our PDB-style files is described here.)

Timeline for d1y7ia_: