SCOPe 2.08: Domain d1y7ia_: 1y7i A:

Lineage for d1y7ia_ (1y7i A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.20: Hydroxynitrile lyase-like [53585] (3 proteins)
   automatically mapped to Pfam PF12697

6. Protein Salicylic acid-binding protein 2 (SABP2) [117707] (1 species)

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [117708] (3 PDB entries)
   Uniprot Q6RYA0

8. Domain d1y7ia_: 1y7i A: [116546]
   Other proteins in same PDB: d1y7ib2
   Structural genomics target
   complexed with sal

Details for d1y7ia_

PDB Entry: 1y7i, 2.1 Å

PDB Description: Structural and biochemical studies identify tobacco SABP2 as a methylsalicylate esterase and further implicate it in plant innate immunity, Northeast Structural Genomics Target AR2241

PDB Compounds: (A:) salicylic acid-binding protein 2

SCOPe Domain Sequences for d1y7ia_:

Sequence; same for both SEQRES and ATOM records:

>d1y7ia_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
egkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlpl
melmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleqy
nertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpsslf
medlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmaml
cepqklcaslleiahkyn

Timeline for d1y7ia_:

• d1y7ia_ first appeared in SCOP 1.71
  
• d1y7ia_ appears in SCOPe 2.07