| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.20: Hydroxynitrile lyase-like [53585] (3 proteins) |
| Protein Salicylic acid-binding protein 2 (SABP2) [117707] (1 species) |
| Species Tobacco (Nicotiana tabacum) [TaxId:4097] [117708] (3 PDB entries) Uniprot Q6RYA0 |
| Domain d1y7hd_: 1y7h D: [116541] Structural genomics target complexed with scn |
PDB Entry: 1y7h (more details), 2.52 Å
SCOPe Domain Sequences for d1y7hd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y7hd_ c.69.1.20 (D:) Salicylic acid-binding protein 2 (SABP2) {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
kegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlp
lmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleq
ynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpssl
fmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmam
lcepqklcaslleiahkyn
Timeline for d1y7hd_: