Lineage for d1y7ha_ (1y7h A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841866Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 841867Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 842582Family c.69.1.20: Hydroxynitrile lyase-like [53585] (2 proteins)
  6. 842619Protein Salicylic acid-binding protein 2 (SABP2) [117707] (1 species)
  7. 842620Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [117708] (3 PDB entries)
    Uniprot Q6RYA0
  8. 842627Domain d1y7ha_: 1y7h A: [116538]
    Structural genomics target

Details for d1y7ha_

PDB Entry: 1y7h (more details), 2.52 Å

PDB Description: structural and biochemical studies identify tobacco sabp2 as a methylsalicylate esterase and further implicate it in plant innate immunity, northeast structural genomics target ar2241
PDB Compounds: (A:) salicylic acid-binding protein 2

SCOP Domain Sequences for d1y7ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7ha_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]}
kegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlp
lmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleq
ynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpssl
fmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmam
lcepqklcaslleiahk

SCOP Domain Coordinates for d1y7ha_:

Click to download the PDB-style file with coordinates for d1y7ha_.
(The format of our PDB-style files is described here.)

Timeline for d1y7ha_: