Class a: All alpha proteins [46456] (226 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (19 species) |
Species Human (Homo sapiens) [TaxId:9606] [46487] (162 PDB entries) |
Domain d1y7dc_: 1y7d C: [116530] Other proteins in same PDB: d1y7db_, d1y7dd_ complexed with hem; mutant |
PDB Entry: 1y7d (more details), 1.9 Å
SCOP Domain Sequences for d1y7dc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y7dc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens)} vlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa vhasldkflasvstvltskyr
Timeline for d1y7dc_: