Lineage for d1y77g_ (1y77 G:)

  1. Root: SCOP 1.71
  2. 627044Class i: Low resolution protein structures [58117] (24 folds)
  3. 628488Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 628489Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 628490Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 628491Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 628492Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (12 PDB entries)
  8. 628571Domain d1y77g_: 1y77 G: [116518]

Details for d1y77g_

PDB Entry: 1y77 (more details), 4.5 Å

PDB Description: Complete RNA Polymerase II elongation complex with substrate analogue GMPCPP

SCOP Domain Sequences for d1y77g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y77g_ i.8.1.1 (G:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae)}
mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqrgr
ilptdgsaefnvkyravvfkpfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdlt
fnagsnppsyqssedvitiksrirvkiegcisqvssihaigsikedylgai

SCOP Domain Coordinates for d1y77g_:

Click to download the PDB-style file with coordinates for d1y77g_.
(The format of our PDB-style files is described here.)

Timeline for d1y77g_: