Lineage for d1y77a_ (1y77 A:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 898089Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 898090Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 898091Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 898092Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 898093Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)
  8. 898217Domain d1y77a_: 1y77 A: [116512]

Details for d1y77a_

PDB Entry: 1y77 (more details), 4.5 Å

PDB Description: Complete RNA Polymerase II elongation complex with substrate analogue GMPCPP
PDB Compounds: (A:) DNA-directed RNA polymerase II largest subunit

SCOP Domain Sequences for d1y77a_:

Sequence, based on SEQRES records: (download)

>d1y77a_ i.8.1.1 (A:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vgqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsi
drnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnel
mrqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglkl
vgswkkdratgdadepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpv
ppppvrpsisfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhva
tymdndiagqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnlel
dqvgvpksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskra
gdiqlqygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynad
fdgdemnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfi
eldqvlnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspk
dngmliidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhng
fstgigdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrf
lneardkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvd
rtlphfskddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrrl
vkaledimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdl
lntdhtldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnir
riiqnaqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccl
lrsrlatrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtl
ntfhfagvaskkvtsgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaieht
tlksvtiaseiyydpdprstvipedeeiiqlhfslldeeaeqsfdqqspwllrleldraa
mndkdltmgqvgerikqtfkndlfviwsedndekliircrvvrpksldaeteaeedhmlk
kientmlenitlrgveniervvmmkydrkvpsptgeyvkepewvletdgvnlsevmtvpg
idptriytnsfidimevlgieagraalykevynviasdgsyvnyrhmallvdvmttqggl
tsvtrhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsenvilgqmapigtgaf
dvmideeslvkymp

Sequence, based on observed residues (ATOM records): (download)

>d1y77a_ i.8.1.1 (A:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vgqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsi
drnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnel
mrqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglkl
vgswkdepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvppppvrps
isfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhvatymdndia
gqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnleldqvgvpks
iaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskragdiqlqyg
wkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynadfdgdemnl
hvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfieldqvlnm
lywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspkdngmliid
gqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhngfstgigdt
iadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrflneardka
grlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvdrtlphfsk
ddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrrlvkaledim
vhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdllntdhtld
psllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnirriiqnaqq
tfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccllrsrlatr
rvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtlkkvtsgvp
rlkeilnvaknmktpsltvylepghaadqeqaklirsaiehttlksvtiaseiyydpdpr
stvipedeeiiqlhfslqqspwllrleldraamndkdltmgqvgerikqtfkndlfviws
edndekliircrvvaeedhmlkkientmlenitlrgveniervvmmkydrkvpsptgeyv
kepewvletdgvnlsevmtvpgidptriytnsfidimevlgieagraalykevynviasd
gsyvnyrhmallvdvmttqggltsvtrhgfnrsntgalmrcsfeetveilfeagasaeld
dcrgvsenvilgqmapigtgafdvmideeslvkymp

SCOP Domain Coordinates for d1y77a_:

Click to download the PDB-style file with coordinates for d1y77a_.
(The format of our PDB-style files is described here.)

Timeline for d1y77a_: