Lineage for d1y6la_ (1y6l A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898312Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1898313Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1898314Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1898322Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1898471Species Human (Homo sapiens), ubch8 [TaxId:9606] [117850] (1 PDB entry)
    Uniprot Q96LR5 54-201
  8. 1898472Domain d1y6la_: 1y6l A: [116509]

Details for d1y6la_

PDB Entry: 1y6l (more details), 1.85 Å

PDB Description: Human ubiquitin conjugating enzyme E2E2
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2E2

SCOPe Domain Sequences for d1y6la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]}
stsakriqkelaeitldpppncsagpkgdniyewrstilgppgsvyeggvfflditfspd
ypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicslltdcnpadpl
vgsiatqymtnraehdrmarqwtkryat

SCOPe Domain Coordinates for d1y6la_:

Click to download the PDB-style file with coordinates for d1y6la_.
(The format of our PDB-style files is described here.)

Timeline for d1y6la_: