SCOPe 2.03: Domain d1y6la_: 1y6l A:

Lineage for d1y6la_ (1y6l A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)

7. Species Human (Homo sapiens), ubch8 [TaxId:9606] [117850] (1 PDB entry)
   Uniprot Q96LR5 54-201

8. Domain d1y6la_: 1y6l A: [116509]

Details for d1y6la_

PDB Entry: 1y6l, 1.85 Å

PDB Description: Human ubiquitin conjugating enzyme E2E2

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2E2

SCOPe Domain Sequences for d1y6la_:

Sequence; same for both SEQRES and ATOM records:

>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]}
stsakriqkelaeitldpppncsagpkgdniyewrstilgppgsvyeggvfflditfspd
ypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicslltdcnpadpl
vgsiatqymtnraehdrmarqwtkryat

Timeline for d1y6la_:

• d1y6la_ first appeared in SCOP 1.71
  
• d1y6la_ appears in SCOPe 2.02
  
• d1y6la_ appears in SCOPe 2.04
  
• d1y6la_ appears in the current release, SCOPe 2.08, called d1y6la1