SCOPe 2.04: Domain d1y6ja1: 1y6j A:7-148

Lineage for d1y6ja1 (1y6j A:7-148)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (18 species)

7. Species Clostridium thermocellum [TaxId:1515] [117432] (1 PDB entry)
   Uniprot Q4CDK5

8. Domain d1y6ja1: 1y6j A:7-148 [116507]
   Other proteins in same PDB: d1y6ja2
   Structural genomics target

Details for d1y6ja1

PDB Entry: 1y6j, 3.01 Å

PDB Description: L-Lactate Dehydrogenase from Clostridium Thermocellum Cth-1135

PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1y6ja1:

Sequence, based on SEQRES records:

>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]}
rskvaiigagfvgasaaftmalrqtanelvlidvfkekaigeamdinhglpfmgqmslya
gdysdvkdcdvivvtaganrkpgetrldlakknvmiakevtqnimkyynhgvilvvsnpv
diitymiqkwsglpvgkvigsg

Sequence, based on observed residues (ATOM records):

>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]}
rskvaiigagfvgasaaftmalrqtanelvlidvfaigeamdinhglpfmgqmslydysd
vkdcdvivvtagatrldlakknvmiakevtqnimkyynhgvilvvsnpvdiitymiqkws
glpvgkvigsg

Timeline for d1y6ja1:

• d1y6ja1 first appeared in SCOP 1.71
  
• d1y6ja1 appears in SCOPe 2.03
  
• d1y6ja1 appears in SCOPe 2.05
  
• d1y6ja1 appears in the current release, SCOPe 2.08