![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins) |
![]() | Protein Lactate dehydrogenase [51859] (14 species) |
![]() | Species Clostridium thermocellum [TaxId:1515] [117432] (1 PDB entry) |
![]() | Domain d1y6ja1: 1y6j A:7-148 [116507] Other proteins in same PDB: d1y6ja2 Structural genomics target |
PDB Entry: 1y6j (more details), 3.01 Å
SCOP Domain Sequences for d1y6ja1:
Sequence, based on SEQRES records: (download)
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum} rskvaiigagfvgasaaftmalrqtanelvlidvfkekaigeamdinhglpfmgqmslya gdysdvkdcdvivvtaganrkpgetrldlakknvmiakevtqnimkyynhgvilvvsnpv diitymiqkwsglpvgkvigsg
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum} rskvaiigagfvgasaaftmalrqtanelvlidvfaigeamdinhglpfmgqmslydysd vkdcdvivvtagatrldlakknvmiakevtqnimkyynhgvilvvsnpvdiitymiqkws glpvgkvigsg
Timeline for d1y6ja1: