Lineage for d1y6ja1 (1y6j A:7-148)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 575610Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
  6. 575649Protein Lactate dehydrogenase [51859] (14 species)
  7. 575666Species Clostridium thermocellum [TaxId:1515] [117432] (1 PDB entry)
  8. 575667Domain d1y6ja1: 1y6j A:7-148 [116507]
    Other proteins in same PDB: d1y6ja2
    Structural genomics target

Details for d1y6ja1

PDB Entry: 1y6j (more details), 3.01 Å

PDB Description: L-Lactate Dehydrogenase from Clostridium Thermocellum Cth-1135

SCOP Domain Sequences for d1y6ja1:

Sequence, based on SEQRES records: (download)

>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum}
rskvaiigagfvgasaaftmalrqtanelvlidvfkekaigeamdinhglpfmgqmslya
gdysdvkdcdvivvtaganrkpgetrldlakknvmiakevtqnimkyynhgvilvvsnpv
diitymiqkwsglpvgkvigsg

Sequence, based on observed residues (ATOM records): (download)

>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum}
rskvaiigagfvgasaaftmalrqtanelvlidvfaigeamdinhglpfmgqmslydysd
vkdcdvivvtagatrldlakknvmiakevtqnimkyynhgvilvvsnpvdiitymiqkws
glpvgkvigsg

SCOP Domain Coordinates for d1y6ja1:

Click to download the PDB-style file with coordinates for d1y6ja1.
(The format of our PDB-style files is described here.)

Timeline for d1y6ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y6ja2