SCOP 1.75: Domain d1y6hb_: 1y6h B:

Lineage for d1y6hb_ (1y6h B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (1 family)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (1 protein)

6. Protein Peptide deformylase [56422] (9 species)

7. Species Leptospira interrogans [TaxId:173] [103340] (1 PDB entry)
   Uniprot Q72S74

8. Domain d1y6hb_: 1y6h B: [116506]
   complexed with cbx, gly, zn

Details for d1y6hb_

PDB Entry: 1y6h, 2.2 Å

PDB Description: Crystal structure of LIPDF

PDB Compounds: (B:) Peptide deformylase

SCOP Domain Sequences for d1y6hb_:

Sequence; same for both SEQRES and ATOM records:

>d1y6hb_ d.167.1.1 (B:) Peptide deformylase {Leptospira interrogans [TaxId: 173]}
svrkilrmgdpilrkisepvtedeiqtkefkklirdmfdtmrhaegvglaapqigilkqi
vvvgsednerypgtpdvperiilnpvitpltkdtsgfwegclsvpgmrgyverpnqirmq
wmdekgnqfdetidgykaivyqhecdhlqgilyvdrlkdtklfgfnetldsshnvld

Timeline for d1y6hb_:

• d1y6hb_ first appeared in SCOP 1.71
  
• d1y6hb_ appears in SCOP 1.73
  
• d1y6hb_ appears in SCOPe 2.01
  
• d1y6hb_ appears in the current release, SCOPe 2.08