Lineage for d1y6hb_ (1y6h B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 614180Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 614181Superfamily d.167.1: Peptide deformylase [56420] (1 family) (S)
    nickel-dependent enzyme
  5. 614182Family d.167.1.1: Peptide deformylase [56421] (1 protein)
  6. 614183Protein Peptide deformylase [56422] (9 species)
  7. 614222Species Leptospira interrogans [TaxId:173] [103340] (1 PDB entry)
  8. 614224Domain d1y6hb_: 1y6h B: [116506]
    complexed with cbx, gly, zn

Details for d1y6hb_

PDB Entry: 1y6h (more details), 2.2 Å

PDB Description: Crystal structure of LIPDF

SCOP Domain Sequences for d1y6hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y6hb_ d.167.1.1 (B:) Peptide deformylase {Leptospira interrogans}
svrkilrmgdpilrkisepvtedeiqtkefkklirdmfdtmrhaegvglaapqigilkqi
vvvgsednerypgtpdvperiilnpvitpltkdtsgfwegclsvpgmrgyverpnqirmq
wmdekgnqfdetidgykaivyqhecdhlqgilyvdrlkdtklfgfnetldsshnvld

SCOP Domain Coordinates for d1y6hb_:

Click to download the PDB-style file with coordinates for d1y6hb_.
(The format of our PDB-style files is described here.)

Timeline for d1y6hb_: