Class a: All alpha proteins [46456] (284 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (6 families) contains additional, fifth helix at the N-terminus |
Family a.24.10.5: Phosphorelay protein luxU [116871] (1 protein) |
Protein Phosphorelay protein luxU [116872] (1 species) |
Species Vibrio harveyi [TaxId:669] [116873] (1 PDB entry) Uniprot Q9ZBB6 |
Domain d1y6da_: 1y6d A: [116504] |
PDB Entry: 1y6d (more details)
SCOPe Domain Sequences for d1y6da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y6da_ a.24.10.5 (A:) Phosphorelay protein luxU {Vibrio harveyi [TaxId: 669]} mntdvlnqqkieelsaeigsdnvpvlldiflgemdsyigtltelqgseqllylkeishal kssaasfgadrlceraiaidkkakanqlqeqgmetsemlallhitrdayrswtn
Timeline for d1y6da_: