SCOP 1.71: Domain d1y6da_: 1y6d A:

Lineage for d1y6da_ (1y6d A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (24 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (5 families)
   contains additional, fifth helix at the N-terminus

5. Family a.24.10.5: Phosphorelay protein luxU [116871] (1 protein)

6. Protein Phosphorelay protein luxU [116872] (1 species)

7. Species Vibrio harveyi [TaxId:669] [116873] (1 PDB entry)

8. Domain d1y6da_: 1y6d A: [116504]

Details for d1y6da_

PDB Entry: 1y6d

PDB Description: solution structure and dynamics of luxu from vibrio harveyi, a phosphotransferase protein involved in bacterial quorum sensing

SCOP Domain Sequences for d1y6da_:

Sequence; same for both SEQRES and ATOM records:

>d1y6da_ a.24.10.5 (A:) Phosphorelay protein luxU {Vibrio harveyi}
mntdvlnqqkieelsaeigsdnvpvlldiflgemdsyigtltelqgseqllylkeishal
kssaasfgadrlceraiaidkkakanqlqeqgmetsemlallhitrdayrswtn

Timeline for d1y6da_:

• d1y6da_ is new in SCOP 1.71
  
• d1y6da_ appears in SCOP 1.73
  
• d1y6da_ appears in the current release, SCOPe 2.08