Lineage for d1y6da_ (1y6d A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700189Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) (S)
    contains additional, fifth helix at the N-terminus
  5. 2700244Family a.24.10.5: Phosphorelay protein luxU [116871] (1 protein)
  6. 2700245Protein Phosphorelay protein luxU [116872] (1 species)
  7. 2700246Species Vibrio harveyi [TaxId:669] [116873] (1 PDB entry)
    Uniprot Q9ZBB6
  8. 2700247Domain d1y6da_: 1y6d A: [116504]

Details for d1y6da_

PDB Entry: 1y6d (more details)

PDB Description: solution structure and dynamics of luxu from vibrio harveyi, a phosphotransferase protein involved in bacterial quorum sensing
PDB Compounds: (A:) Phosphorelay protein luxU

SCOPe Domain Sequences for d1y6da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y6da_ a.24.10.5 (A:) Phosphorelay protein luxU {Vibrio harveyi [TaxId: 669]}
mntdvlnqqkieelsaeigsdnvpvlldiflgemdsyigtltelqgseqllylkeishal
kssaasfgadrlceraiaidkkakanqlqeqgmetsemlallhitrdayrswtn

SCOPe Domain Coordinates for d1y6da_:

Click to download the PDB-style file with coordinates for d1y6da_.
(The format of our PDB-style files is described here.)

Timeline for d1y6da_: