![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
![]() | Protein Mn superoxide dismutase (MnSOD) [54721] (9 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [117896] (2 PDB entries) Uniprot Q9RUV2 |
![]() | Domain d1y67d2: 1y67 D:98-211 [116503] Other proteins in same PDB: d1y67a1, d1y67a3, d1y67a4, d1y67b1, d1y67b3, d1y67c1, d1y67c3, d1y67d1, d1y67d3 complexed with fe |
PDB Entry: 1y67 (more details), 1.85 Å
SCOPe Domain Sequences for d1y67d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y67d2 d.44.1.1 (D:98-211) Mn superoxide dismutase (MnSOD) {Deinococcus radiodurans [TaxId: 1299]} nqpsgelldainsafgsfdafkqkfedaaktrfgsgwawlvvkdgkldvvstanqdnplm geaiagvsgtpilgvdvwehayylnyqnrrpdylaafwnvvnwdevskryaaak
Timeline for d1y67d2: