![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
![]() | Protein Mn superoxide dismutase (MnSOD) [46618] (9 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [116763] (2 PDB entries) Uniprot Q9RUV2 |
![]() | Domain d1y67d1: 1y67 D:2-89 [116502] Other proteins in same PDB: d1y67a2, d1y67a3, d1y67a4, d1y67b2, d1y67b3, d1y67c2, d1y67c3, d1y67d2, d1y67d3 complexed with fe |
PDB Entry: 1y67 (more details), 1.85 Å
SCOPe Domain Sequences for d1y67d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y67d1 a.2.11.1 (D:2-89) Mn superoxide dismutase (MnSOD) {Deinococcus radiodurans [TaxId: 1299]} aytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqqld rvpadkkgalrnnagghanhsmfwqimg
Timeline for d1y67d1: