SCOPe 2.07: Domain d1y67b2: 1y67 B:98-211

Lineage for d1y67b2 (1y67 B:98-211)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)

7. Species Deinococcus radiodurans [TaxId:1299] [117896] (2 PDB entries)
   Uniprot Q9RUV2

8. Domain d1y67b2: 1y67 B:98-211 [116499]
   Other proteins in same PDB: d1y67a1, d1y67a3, d1y67a4, d1y67b1, d1y67b3, d1y67c1, d1y67c3, d1y67d1, d1y67d3
   complexed with fe

Details for d1y67b2

PDB Entry: 1y67, 1.85 Å

PDB Description: crystal structure of manganese superoxide dismutase from deinococcus radiodurans

PDB Compounds: (B:) manganese superoxide dismutase

SCOPe Domain Sequences for d1y67b2:

Sequence; same for both SEQRES and ATOM records:

>d1y67b2 d.44.1.1 (B:98-211) Mn superoxide dismutase (MnSOD) {Deinococcus radiodurans [TaxId: 1299]}
nqpsgelldainsafgsfdafkqkfedaaktrfgsgwawlvvkdgkldvvstanqdnplm
geaiagvsgtpilgvdvwehayylnyqnrrpdylaafwnvvnwdevskryaaak

Timeline for d1y67b2:

• d1y67b2 first appeared in SCOP 1.71
  
• d1y67b2 appears in SCOPe 2.06
  
• d1y67b2 appears in the current release, SCOPe 2.08