Lineage for d1y67b2 (1y67 B:98-211)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946003Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2946129Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 2946142Species Deinococcus radiodurans [TaxId:1299] [117896] (2 PDB entries)
    Uniprot Q9RUV2
  8. 2946144Domain d1y67b2: 1y67 B:98-211 [116499]
    Other proteins in same PDB: d1y67a1, d1y67a3, d1y67a4, d1y67b1, d1y67b3, d1y67c1, d1y67c3, d1y67d1, d1y67d3
    complexed with fe

Details for d1y67b2

PDB Entry: 1y67 (more details), 1.85 Å

PDB Description: crystal structure of manganese superoxide dismutase from deinococcus radiodurans
PDB Compounds: (B:) manganese superoxide dismutase

SCOPe Domain Sequences for d1y67b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y67b2 d.44.1.1 (B:98-211) Mn superoxide dismutase (MnSOD) {Deinococcus radiodurans [TaxId: 1299]}
nqpsgelldainsafgsfdafkqkfedaaktrfgsgwawlvvkdgkldvvstanqdnplm
geaiagvsgtpilgvdvwehayylnyqnrrpdylaafwnvvnwdevskryaaak

SCOPe Domain Coordinates for d1y67b2:

Click to download the PDB-style file with coordinates for d1y67b2.
(The format of our PDB-style files is described here.)

Timeline for d1y67b2: