Lineage for d1y67a1 (1y67 A:2-89)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979497Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1979785Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1979786Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 protein domains)
  6. 1979912Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)
  7. 1979925Species Deinococcus radiodurans [TaxId:1299] [116763] (2 PDB entries)
    Uniprot Q9RUV2
  8. 1979926Domain d1y67a1: 1y67 A:2-89 [116496]
    Other proteins in same PDB: d1y67a2, d1y67a3, d1y67a4, d1y67b2, d1y67b3, d1y67c2, d1y67c3, d1y67d2, d1y67d3
    complexed with fe

Details for d1y67a1

PDB Entry: 1y67 (more details), 1.85 Å

PDB Description: Crystal Structure of Manganese Superoxide Dismutase from Deinococcus radiodurans
PDB Compounds: (A:) manganese superoxide dismutase

SCOPe Domain Sequences for d1y67a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y67a1 a.2.11.1 (A:2-89) Mn superoxide dismutase (MnSOD) {Deinococcus radiodurans [TaxId: 1299]}
aytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqqld
rvpadkkgalrnnagghanhsmfwqimg

SCOPe Domain Coordinates for d1y67a1:

Click to download the PDB-style file with coordinates for d1y67a1.
(The format of our PDB-style files is described here.)

Timeline for d1y67a1: