Lineage for d1y65a_ (1y65 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 571086Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) (S)
  5. 572153Family c.1.8.7: NagZ-like [51553] (2 proteins)
    Pfam 00933; Glycosyl hydrolase family 3 domain
  6. 572163Protein Beta-hexosaminidase NagZ [117370] (1 species)
  7. 572164Species Vibrio cholerae [TaxId:666] [117371] (2 PDB entries)
  8. 572166Domain d1y65a_: 1y65 A: [116495]
    complexed with nag

Details for d1y65a_

PDB Entry: 1y65 (more details), 1.85 Å

PDB Description: crystal structure of beta-hexosaminidase from vibrio cholerae in complex with n-acetyl-d-glucosamine to a resolution of 1.85

SCOP Domain Sequences for d1y65a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y65a_ c.1.8.7 (A:) Beta-hexosaminidase NagZ {Vibrio cholerae}
slgplwldvagyelsaedreilqhptvggvilfgrnyhdnqqllalnkairqaakrpili
gvdqeggrvqrfregfsrippaqyyaraengvelaeqggwlmaaeliahdvdlsfapvld
mgfackaignrafgedvqtvlkhssaflrgmkavgmattgkhfpghgaviadshletpyd
eretiaqdmaifraqieagvldammpahvvyphydaqpasgssywlkqvlreelgfkgiv
fsddlsmegaavmggpvershqalvagcdmilicnkreaavevldnlpimevpqaeallk
kqqfsyselkrlerwqqasanmqrlieqfs

SCOP Domain Coordinates for d1y65a_:

Click to download the PDB-style file with coordinates for d1y65a_.
(The format of our PDB-style files is described here.)

Timeline for d1y65a_: