Lineage for d1y65a1 (1y65 A:2-329)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. Family c.1.8.7: NagZ-like [51553] (4 proteins)
    Pfam PF00933; Glycosyl hydrolase family 3 domain
    Some members have reversed beta strand compared to other members of fold
  6. Protein Beta-hexosaminidase NagZ [117370] (1 species)
  7. Species Vibrio cholerae [TaxId:666] [117371] (3 PDB entries)
    Uniprot Q9KU37
  8. Domain d1y65a1: 1y65 A:2-329 [116495]
    Other proteins in same PDB: d1y65a2
    complexed with nag

Details for d1y65a1

PDB Entry: 1y65 (more details), 1.85 Å

PDB Description: crystal structure of beta-hexosaminidase from vibrio cholerae in complex with n-acetyl-d-glucosamine to a resolution of 1.85
PDB Compounds: (A:) Beta-hexosaminidase

SCOPe Domain Sequences for d1y65a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y65a1 c.1.8.7 (A:2-329) Beta-hexosaminidase NagZ {Vibrio cholerae [TaxId: 666]}
gplwldvagyelsaedreilqhptvggvilfgrnyhdnqqllalnkairqaakrpiligv
dqeggrvqrfregfsrippaqyyaraengvelaeqggwlmaaeliahdvdlsfapvldmg
fackaignrafgedvqtvlkhssaflrgmkavgmattgkhfpghgaviadshletpyder
etiaqdmaifraqieagvldammpahvvyphydaqpasgssywlkqvlreelgfkgivfs
ddlsmegaavmggpvershqalvagcdmilicnkreaavevldnlpimevpqaeallkkq
qfsyselkrlerwqqasanmqrlieqfs

SCOPe Domain Coordinates for d1y65a1 are not available.

Timeline for d1y65a1:

Domains from same chain:
(mouse over for more information)
d1y65a2