Lineage for d1y63a_ (1y63 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2866067Protein Probable kinase LmjF30.1890 [117528] (1 species)
  7. 2866068Species Leishmania major [TaxId:5664] [117529] (1 PDB entry)
    Uniprot Q4Q7A6
  8. 2866069Domain d1y63a_: 1y63 A: [116494]
    Structural genomics target
    complexed with adp, br, mn, na

Details for d1y63a_

PDB Entry: 1y63 (more details), 1.7 Å

PDB Description: initial crystal structural analysis of a probable kinase from leishmania major friedlin
PDB Compounds: (A:) Lmaj004144AAA protein

SCOPe Domain Sequences for d1y63a_:

Sequence, based on SEQRES records: (download)

>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]}
eqpkginilitgtpgtgktsmaemiaaeldgfqhlevgklvkenhfyteydteldthiie
ekdedrlldfmepimvsrgnhvvdyhsselfperwfhmvvvlhtstevlferltkrqyse
akraenmeaeiqciceeeardayeddivlvrendtleqmaatveeirervevlk

Sequence, based on observed residues (ATOM records): (download)

>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]}
eqpkginilitgtpgtgktsmaemiaaeldgfqhlevgklvkenhfytethiieekdedr
lldfmepimvsrgnhvvdyhsselfperwfhmvvvlhtstevlferltkrqyseakraen
meaeiqciceeeardayeddivlvrendtleqmaatveeirervevlk

SCOPe Domain Coordinates for d1y63a_:

Click to download the PDB-style file with coordinates for d1y63a_.
(The format of our PDB-style files is described here.)

Timeline for d1y63a_: