Lineage for d1y60e_ (1y60 E:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716671Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 716672Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 717067Family d.14.1.12: Formaldehyde-activating enzyme, FAE [117795] (1 protein)
    modification of the common fold; contains extra alpha-beta unit after strand 2, the extra strand extends beta-sheet antiparallel to strand 3
  6. 717068Protein Formaldehyde-activating enzyme, FAE [117796] (1 species)
  7. 717069Species Methylobacterium extorquens [TaxId:408] [117797] (2 PDB entries)
  8. 717074Domain d1y60e_: 1y60 E: [116493]
    complexed with h4m

Details for d1y60e_

PDB Entry: 1y60 (more details), 1.9 Å

PDB Description: Structure of the tetrahydromethanopterin dependent formaldehyde-activating enzyme (Fae) from Methylobacterium extorquens AM1 with bound 5,10-methylene tetrahydromethanopterin
PDB Compounds: (E:) Formaldehyde-activating enzyme fae

SCOP Domain Sequences for d1y60e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y60e_ d.14.1.12 (E:) Formaldehyde-activating enzyme, FAE {Methylobacterium extorquens [TaxId: 408]}
akitkvqvgealvgdgnevahidliigprgspaetafcnglvnnkhgftsllaviapnlp
ckpntlmfnkvtindarqavqmfgpaqhgvamavqdavaegiipadeaddlyvlvgvfih
weaaddakiqkynyeatklsiqravngepkasvvteqrksathpfaan

SCOP Domain Coordinates for d1y60e_:

Click to download the PDB-style file with coordinates for d1y60e_.
(The format of our PDB-style files is described here.)

Timeline for d1y60e_: