![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.12: Formaldehyde-activating enzyme, FAE [117795] (1 protein) modification of the common fold; contains extra alpha-beta unit after strand 2, the extra strand extends beta-sheet antiparallel to strand 3 automatically mapped to Pfam PF08714 |
![]() | Protein Formaldehyde-activating enzyme, FAE [117796] (1 species) |
![]() | Species Methylobacterium extorquens [TaxId:408] [117797] (2 PDB entries) Uniprot Q9FA38 |
![]() | Domain d1y60c_: 1y60 C: [116491] complexed with h4m |
PDB Entry: 1y60 (more details), 1.9 Å
SCOPe Domain Sequences for d1y60c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y60c_ d.14.1.12 (C:) Formaldehyde-activating enzyme, FAE {Methylobacterium extorquens [TaxId: 408]} akitkvqvgealvgdgnevahidliigprgspaetafcnglvnnkhgftsllaviapnlp ckpntlmfnkvtindarqavqmfgpaqhgvamavqdavaegiipadeaddlyvlvgvfih weaaddakiqkynyeatklsiqravngepkasvvteqrksathpfaan
Timeline for d1y60c_:
![]() Domains from other chains: (mouse over for more information) d1y60a_, d1y60b_, d1y60d_, d1y60e_ |