Lineage for d1y60a_ (1y60 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. Family d.14.1.12: Formaldehyde-activating enzyme, FAE [117795] (1 protein)
    modification of the common fold; contains extra alpha-beta unit after strand 2, the extra strand extends beta-sheet antiparallel to strand 3
    automatically mapped to Pfam PF08714
  6. Protein Formaldehyde-activating enzyme, FAE [117796] (1 species)
  7. Species Methylobacterium extorquens [TaxId:408] [117797] (2 PDB entries)
    Uniprot Q9FA38
  8. Domain d1y60a_: 1y60 A: [116489]
    complexed with h4m

Details for d1y60a_

PDB Entry: 1y60 (more details), 1.9 Å

PDB Description: Structure of the tetrahydromethanopterin dependent formaldehyde-activating enzyme (Fae) from Methylobacterium extorquens AM1 with bound 5,10-methylene tetrahydromethanopterin
PDB Compounds: (A:) Formaldehyde-activating enzyme fae

SCOPe Domain Sequences for d1y60a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y60a_ d.14.1.12 (A:) Formaldehyde-activating enzyme, FAE {Methylobacterium extorquens [TaxId: 408]}
akitkvqvgealvgdgnevahidliigprgspaetafcnglvnnkhgftsllaviapnlp
ckpntlmfnkvtindarqavqmfgpaqhgvamavqdavaegiipadeaddlyvlvgvfih
weaaddakiqkynyeatklsiqravngepkasvvteqrksathpfaan

SCOPe Domain Coordinates for d1y60a_ are not available.

Timeline for d1y60a_:

Domains from other chains:
(mouse over for more information)
d1y60b_, d1y60c_, d1y60d_, d1y60e_