![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.12: Formaldehyde-activating enzyme, FAE [117795] (1 protein) modification of the common fold; contains extra alpha-beta unit after strand 2, the extra strand extends beta-sheet antiparallel to strand 3 automatically mapped to Pfam PF08714 |
![]() | Protein Formaldehyde-activating enzyme, FAE [117796] (1 species) |
![]() | Species Methylobacterium extorquens [TaxId:408] [117797] (2 PDB entries) Uniprot Q9FA38 |
![]() | Domain d1y5ye_: 1y5y E: [116488] complexed with ca, na |
PDB Entry: 1y5y (more details), 2 Å
SCOPe Domain Sequences for d1y5ye_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y5ye_ d.14.1.12 (E:) Formaldehyde-activating enzyme, FAE {Methylobacterium extorquens [TaxId: 408]} akitkvqvgealvgdgnevahidliigprgspaetafcnglvnnkhgftsllaviapnlp ckpntlmfnkvtindarqavqmfgpaqhgvamavqdavaegiipadeaddlyvlvgvfih weaaddakiqkynyeatklsiqravngepkasvvteqr
Timeline for d1y5ye_:
![]() Domains from other chains: (mouse over for more information) d1y5ya_, d1y5yb_, d1y5yc_, d1y5yd_ |