Class a: All alpha proteins [46456] (258 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (19 species) |
Species Human (Homo sapiens) [TaxId:9606] [46487] (178 PDB entries) |
Domain d1y5jc_: 1y5j C: [116478] Other proteins in same PDB: d1y5jb_, d1y5jd_ complexed with hem; mutant |
PDB Entry: 1y5j (more details), 2.03 Å
SCOP Domain Sequences for d1y5jc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y5jc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]} vlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa vhasldkflasvstvltskyr
Timeline for d1y5jc_: