Lineage for d1y4wa2 (1y4w A:20-372)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 807084Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 807090Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (5 families) (S)
  5. 807150Family b.67.2.3: Glycosyl hydrolases family 32 N-terminal domain [101884] (2 proteins)
    Pfam PF00251; Glycosyl hydrolase family 32
  6. 807165Protein Exo-inulinase [117272] (1 species)
  7. 807166Species Aspergillus awamori [TaxId:105351] [117273] (3 PDB entries)
    Uniprot Q96TU3 20-536
  8. 807167Domain d1y4wa2: 1y4w A:20-372 [116471]
    Other proteins in same PDB: d1y4wa1
    complexed with gol, nag

Details for d1y4wa2

PDB Entry: 1y4w (more details), 1.55 Å

PDB Description: crystal structure of exo-inulinase from aspergillus awamori in spacegroup p21
PDB Compounds: (A:) exo-inulinase

SCOP Domain Sequences for d1y4wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y4wa2 b.67.2.3 (A:20-372) Exo-inulinase {Aspergillus awamori [TaxId: 105351]}
fnydqpyrgqyhfspqknwmndpngllyhngtyhlffqynpggiewgniswghaisedlt
hweekpvallargfgsdvtemyfsgsavadvnntsgfgkdgktplvamytsyypvaqtlp
sgqtvqedqqsqsiayslddgltwttydaanpvipnppspyeaeyqnfrdpfvfwhdesq
kwvvvtsiaelhklaiytsdnlkdwklvsefgpynaqggvwecpglvklpldsgnstkwv
itsglnpggppgtvgsgtqyfvgefdgttftpdadtvypgnstanwmdwgpdfyaaagyn
glslndhvhigwmnnwqyganiptypwrsamaiprhmalktigskatlvqqpq

SCOP Domain Coordinates for d1y4wa2:

Click to download the PDB-style file with coordinates for d1y4wa2.
(The format of our PDB-style files is described here.)

Timeline for d1y4wa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y4wa1