Class b: All beta proteins [48724] (177 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.19: Glycosyl hydrolases family 32 C-terminal domain [101652] (2 proteins) Pfam PF08244 flat sheet beta-sandwich lacking the characteristic beta-bulge in the C-terminal strand |
Protein Exo-inulinase [117137] (1 species) |
Species Aspergillus awamori [TaxId:105351] [117138] (3 PDB entries) Uniprot Q96TU3 20-536 |
Domain d1y4wa1: 1y4w A:373-536 [116470] Other proteins in same PDB: d1y4wa2 complexed with gol, nag |
PDB Entry: 1y4w (more details), 1.55 Å
SCOPe Domain Sequences for d1y4wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y4wa1 b.29.1.19 (A:373-536) Exo-inulinase {Aspergillus awamori [TaxId: 105351]} eawssisnkrpiysrtfktlsegstnttttgetfkvdlsfsakskastfaialrasanft eqtlvgydfakqqifldrthsgdvsfdetfasvyhgpltpdstgvvklsifvdrssvevf ggqgettltaqifpssdavharlastggttedvradiykiastw
Timeline for d1y4wa1: