SCOPe 2.02: Domain d1y4wa1: 1y4w A:373-536

Lineage for d1y4wa1 (1y4w A:373-536)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.19: Glycosyl hydrolases family 32 C-terminal domain [101652] (2 proteins)
   Pfam PF08244
   flat sheet beta-sandwich lacking the characteristic beta-bulge in the C-terminal strand

6. Protein Exo-inulinase [117137] (1 species)

7. Species Aspergillus awamori [TaxId:105351] [117138] (3 PDB entries)
   Uniprot Q96TU3 20-536

8. Domain d1y4wa1: 1y4w A:373-536 [116470]
   Other proteins in same PDB: d1y4wa2
   complexed with gol, nag

Details for d1y4wa1

PDB Entry: 1y4w, 1.55 Å

PDB Description: crystal structure of exo-inulinase from aspergillus awamori in spacegroup p21

PDB Compounds: (A:) exo-inulinase

SCOPe Domain Sequences for d1y4wa1:

Sequence; same for both SEQRES and ATOM records:

>d1y4wa1 b.29.1.19 (A:373-536) Exo-inulinase {Aspergillus awamori [TaxId: 105351]}
eawssisnkrpiysrtfktlsegstnttttgetfkvdlsfsakskastfaialrasanft
eqtlvgydfakqqifldrthsgdvsfdetfasvyhgpltpdstgvvklsifvdrssvevf
ggqgettltaqifpssdavharlastggttedvradiykiastw

Timeline for d1y4wa1:

• d1y4wa1 first appeared in SCOP 1.71
  
• d1y4wa1 appears in SCOPe 2.01
  
• d1y4wa1 appears in SCOPe 2.03
  
• d1y4wa1 appears in the current release, SCOPe 2.08