Lineage for d1y4vb_ (1y4v B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1716690Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 1716811Species Human (Homo sapiens) [TaxId:9606] [46501] (225 PDB entries)
    Uniprot P68871
  8. 1716951Domain d1y4vb_: 1y4v B: [116467]
    Other proteins in same PDB: d1y4va_, d1y4vc_
    complexed with hem

Details for d1y4vb_

PDB Entry: 1y4v (more details), 1.84 Å

PDB Description: t-to-t(high) quaternary transitions in human hemoglobin: betac93a deoxy low-salt (1 test set)
PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d1y4vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y4vb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhadklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d1y4vb_:

Click to download the PDB-style file with coordinates for d1y4vb_.
(The format of our PDB-style files is described here.)

Timeline for d1y4vb_: