Lineage for d1y4td_ (1y4t D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2162069Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2162244Protein Ferric-binding protein FbpA [53867] (7 species)
  7. 2162247Species Campylobacter jejuni [TaxId:197] [117744] (2 PDB entries)
    Uniprot Q9PIV4 17-334
  8. 2162250Domain d1y4td_: 1y4t D: [116465]
    complexed with fe

Details for d1y4td_

PDB Entry: 1y4t (more details), 1.8 Å

PDB Description: Ferric binding protein from Campylobacter jejuni
PDB Compounds: (D:) putative iron-uptake ABC transport system periplasmic iron-binding protein

SCOPe Domain Sequences for d1y4td_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y4td_ c.94.1.1 (D:) Ferric-binding protein FbpA {Campylobacter jejuni [TaxId: 197]}
elniysarhynadfeiikkfeektgikvnhtqakaselikrlslegsnspadifitadis
nlteaknlgllspvsskyleefipahlrdkdkewfaitkrariiaynkntnidiskmkny
edlakaefkgeivmrsatapysktllasiiandgnkeakawakgvlenlatnpkggdrdq
arqvfageakfavmntyyigllknsknpkdvevgnslgiifpnqdnrgthinisgiamtk
ssknqdaakkfmefmlspeiqkiltdsnyefpirndvelsqtvkdfgtfkedqipvskia
enikeavkiydevgfr

SCOPe Domain Coordinates for d1y4td_:

Click to download the PDB-style file with coordinates for d1y4td_.
(The format of our PDB-style files is described here.)

Timeline for d1y4td_: