Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
Protein Ferric-binding protein FbpA [53867] (7 species) |
Species Campylobacter jejuni [TaxId:197] [117744] (2 PDB entries) Uniprot Q9PIV4 17-334 |
Domain d1y4td_: 1y4t D: [116465] complexed with fe |
PDB Entry: 1y4t (more details), 1.8 Å
SCOPe Domain Sequences for d1y4td_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y4td_ c.94.1.1 (D:) Ferric-binding protein FbpA {Campylobacter jejuni [TaxId: 197]} elniysarhynadfeiikkfeektgikvnhtqakaselikrlslegsnspadifitadis nlteaknlgllspvsskyleefipahlrdkdkewfaitkrariiaynkntnidiskmkny edlakaefkgeivmrsatapysktllasiiandgnkeakawakgvlenlatnpkggdrdq arqvfageakfavmntyyigllknsknpkdvevgnslgiifpnqdnrgthinisgiamtk ssknqdaakkfmefmlspeiqkiltdsnyefpirndvelsqtvkdfgtfkedqipvskia enikeavkiydevgfr
Timeline for d1y4td_: