SCOPe 2.08: Domain d1y4ta_: 1y4t A:

Lineage for d1y4ta_ (1y4t A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Ferric-binding protein FbpA [53867] (7 species)

7. Species Campylobacter jejuni [TaxId:197] [117744] (2 PDB entries)
   Uniprot Q9PIV4 17-334

8. Domain d1y4ta_: 1y4t A: [116464]
   complexed with fe
   has additional insertions and/or extensions that are not grouped together

Details for d1y4ta_

PDB Entry: 1y4t, 1.8 Å

PDB Description: Ferric binding protein from Campylobacter jejuni

PDB Compounds: (A:) putative iron-uptake ABC transport system periplasmic iron-binding protein

SCOPe Domain Sequences for d1y4ta_:

Sequence; same for both SEQRES and ATOM records:

>d1y4ta_ c.94.1.1 (A:) Ferric-binding protein FbpA {Campylobacter jejuni [TaxId: 197]}
selniysarhynadfeiikkfeektgikvnhtqakaselikrlslegsnspadifitadi
snlteaknlgllspvsskyleefipahlrdkdkewfaitkrariiaynkntnidiskmkn
yedlakaefkgeivmrsatapysktllasiiandgnkeakawakgvlenlatnpkggdrd
qarqvfageakfavmntyyigllknsknpkdvevgnslgiifpnqdnrgthinisgiamt
kssknqdaakkfmefmlspeiqkiltdsnyefpirndvelsqtvkdfgtfkedqipvski
aenikeavkiydevgfr

Timeline for d1y4ta_:

• d1y4ta_ first appeared in SCOP 1.71
  
• d1y4ta_ appears in SCOPe 2.07