Class a: All alpha proteins [46456] (286 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (24 species) |
Species Human (Homo sapiens) [TaxId:9606] [46501] (225 PDB entries) Uniprot P68871 |
Domain d1y4qb_: 1y4q B: [116457] Other proteins in same PDB: d1y4qa_, d1y4qc_ complexed with hem |
PDB Entry: 1y4q (more details), 2.11 Å
SCOPe Domain Sequences for d1y4qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y4qb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]} mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrfaesfgdlstpdavmgnpkv kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk eftppvqaayqkvvagvanalahkyh
Timeline for d1y4qb_: