Lineage for d1y46d_ (1y46 D:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 632305Protein Hemoglobin, beta-chain [46500] (22 species)
  7. 632381Species Human (Homo sapiens) [TaxId:9606] [46501] (173 PDB entries)
  8. 632640Domain d1y46d_: 1y46 D: [116439]
    Other proteins in same PDB: d1y46a_, d1y46c_
    complexed with hem; mutant

Details for d1y46d_

PDB Entry: 1y46 (more details), 2.22 Å

PDB Description: t-to-t(high) quaternary transitions in human hemoglobin: betaw37y deoxy low-salt (10 test sets)
PDB Compounds: (D:) hemoglobin beta chain

SCOP Domain Sequences for d1y46d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y46d_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggealgrllvvypytqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1y46d_:

Click to download the PDB-style file with coordinates for d1y46d_.
(The format of our PDB-style files is described here.)

Timeline for d1y46d_: