Class a: All alpha proteins [46456] (226 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (22 species) |
Species Human (Homo sapiens) [TaxId:9606] [46501] (159 PDB entries) |
Domain d1y46d_: 1y46 D: [116439] Other proteins in same PDB: d1y46a_, d1y46c_ complexed with hem; mutant |
PDB Entry: 1y46 (more details), 2.22 Å
SCOP Domain Sequences for d1y46d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y46d_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens)} mhltpeeksavtalwgkvnvdevggealgrllvvypytqrffesfgdlstpdavmgnpkv kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk eftppvqaayqkvvagvanalahkyh
Timeline for d1y46d_: