SCOP 1.75: Domain d1y46b_: 1y46 B:

Lineage for d1y46b_ (1y46 B:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (177 PDB entries)
   Uniprot P68871

8. Domain d1y46b_: 1y46 B: [116437]
   Other proteins in same PDB: d1y46a_, d1y46c_

Details for d1y46b_

PDB Entry: 1y46, 2.22 Å

PDB Description: t-to-t(high) quaternary transitions in human hemoglobin: betaw37y deoxy low-salt (10 test sets)

PDB Compounds: (B:) hemoglobin beta chain

SCOP Domain Sequences for d1y46b_:

Sequence; same for both SEQRES and ATOM records:

>d1y46b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggealgrllvvypytqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d1y46b_:

• d1y46b_ first appeared in SCOP 1.71
  
• d1y46b_ appears in SCOP 1.73
  
• d1y46b_ appears in SCOPe 2.01
  
• d1y46b_ appears in the current release, SCOPe 2.08