Lineage for d1y41a_ (1y41 A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 568472Fold b.88: Mss4-like [51315] (1 superfamily)
    complex fold made of several coiled beta-sheets
  4. 568473Superfamily b.88.1: Mss4-like [51316] (4 families) (S)
    duplication: tandem repeat of two similar structural motifs
  5. 568481Family b.88.1.2: Translationally controlled tumor protein TCTP (histamine-releasing factor) [63873] (1 protein)
    contains an insertion of alpha helical hairpin; lacks zinc-binding site
  6. 568482Protein Translationally controlled tumor protein TCTP (histamine-releasing factor) [63874] (3 species)
  7. 568486Species Human (Homo sapiens) [TaxId:9606] [117337] (1 PDB entry)
  8. 568487Domain d1y41a_: 1y41 A: [116431]

Details for d1y41a_

PDB Entry: 1y41 (more details)

PDB Description: Solution structure of human translationally controlled tumor protein

SCOP Domain Sequences for d1y41a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y41a_ b.88.1.2 (A:) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Human (Homo sapiens)}
miiyrdlishdemfsdiykireiadglclevegkmvsrtegniddsliggnasaegpege
gtestvitgvdivmnhhlqetsftkeaykkyikdymksikgkleeqrpervkpfmtgaae
qikhilanfknyqffigenmnpdgmvalldyredgvtpymiffkdglemekclehhhhhh

SCOP Domain Coordinates for d1y41a_:

Click to download the PDB-style file with coordinates for d1y41a_.
(The format of our PDB-style files is described here.)

Timeline for d1y41a_:

  • d1y41a_ is new in SCOP 1.71
  • d1y41a_ does not appear in SCOP 1.73