| Class b: All beta proteins [48724] (149 folds) |
| Fold b.88: Mss4-like [51315] (1 superfamily) complex fold made of several coiled beta-sheets |
Superfamily b.88.1: Mss4-like [51316] (4 families) ![]() duplication: tandem repeat of two similar structural motifs |
| Family b.88.1.2: Translationally controlled tumor protein TCTP (histamine-releasing factor) [63873] (1 protein) contains an insertion of alpha helical hairpin; lacks zinc-binding site |
| Protein Translationally controlled tumor protein TCTP (histamine-releasing factor) [63874] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [117337] (1 PDB entry) |
| Domain d1y41a_: 1y41 A: [116431] |
PDB Entry: 1y41 (more details)
SCOP Domain Sequences for d1y41a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y41a_ b.88.1.2 (A:) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Human (Homo sapiens)}
miiyrdlishdemfsdiykireiadglclevegkmvsrtegniddsliggnasaegpege
gtestvitgvdivmnhhlqetsftkeaykkyikdymksikgkleeqrpervkpfmtgaae
qikhilanfknyqffigenmnpdgmvalldyredgvtpymiffkdglemekclehhhhhh
Timeline for d1y41a_: