Lineage for d1y31b_ (1y31 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1977385Protein Hemoglobin, beta-chain [46500] (25 species)
  7. 1977509Species Human (Homo sapiens) [TaxId:9606] [46501] (233 PDB entries)
    Uniprot P68871
  8. 1977778Domain d1y31b_: 1y31 B: [116424]
    Other proteins in same PDB: d1y31a_, d1y31c_
    complexed with hem

Details for d1y31b_

PDB Entry: 1y31 (more details), 2.13 Å

PDB Description: T-To-T(High) quaternary transitions in human hemoglobin: betaY35A deoxy low-salt (1 test set)
PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d1y31b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y31b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggealgrllvvapwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d1y31b_:

Click to download the PDB-style file with coordinates for d1y31b_.
(The format of our PDB-style files is described here.)

Timeline for d1y31b_: