SCOP 1.71: Domain d1y2wb_: 1y2w B:

Lineage for d1y2wb_ (1y2w B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
   sandwich, 10 strands in 2 sheets;

4. Superfamily b.97.1: Cytolysin/lectin [63724] (2 families)
   some topological similarity to osmotin

5. Family b.97.1.2: Fungal fruit body lectin [117119] (2 proteins)
   Pfam 07367

6. Protein TF antigen-binding lectin [117122] (1 species)

7. Species Common mushroom (Agaricus bisporus) [TaxId:5341] [117123] (5 PDB entries)

8. Domain d1y2wb_: 1y2w B: [116414]
   complexed with gal, nag, nga, ser

Details for d1y2wb_

PDB Entry: 1y2w, 1.74 Å

PDB Description: crystal structure of the orthorhombic form of the common edible mushroom (agaricus bisporus) lectin in complex with t-antigen and n- acetylglucosamine

SCOP Domain Sequences for d1y2wb_:

Sequence; same for both SEQRES and ATOM records:

>d1y2wb_ b.97.1.2 (B:) TF antigen-binding lectin {Common mushroom (Agaricus bisporus)}
tytisirvyqttpkgffrpvertnwkyanggtwdevrgeyvltmggsgtsgslrfvssdt
desfvatfgvhnykrwcdivtnltneqtalvinqeyygvpirdqarenqltsynvanakg
rrfaieytvtegdnlkanliig

Timeline for d1y2wb_:

• d1y2wb_ is new in SCOP 1.71
  
• d1y2wb_ appears in SCOP 1.73
  
• d1y2wb_ appears in the current release, SCOPe 2.08