Lineage for d1y2wa_ (1y2w A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 965492Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
    sandwich, 10 strands in 2 sheets;
  4. 965493Superfamily b.97.1: Cytolysin/lectin [63724] (2 families) (S)
    some topological similarity to osmotin
  5. 965509Family b.97.1.2: Fungal fruit body lectin [117119] (3 proteins)
    Pfam PF07367
  6. 965514Protein TF antigen-binding lectin [117122] (1 species)
  7. 965515Species Common mushroom (Agaricus bisporus) [TaxId:5341] [117123] (5 PDB entries)
    Uniprot Q00022
  8. 965518Domain d1y2wa_: 1y2w A: [116413]
    complexed with nag, ser

Details for d1y2wa_

PDB Entry: 1y2w (more details), 1.74 Å

PDB Description: crystal structure of the orthorhombic form of the common edible mushroom (agaricus bisporus) lectin in complex with t-antigen and n- acetylglucosamine
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d1y2wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y2wa_ b.97.1.2 (A:) TF antigen-binding lectin {Common mushroom (Agaricus bisporus) [TaxId: 5341]}
tytisirvyqttpkgffrpvertnwkyanggtwdevrgeyvltmggsgtsgslrfvssdt
desfvatfgvhnykrwcdivtnltneqtalvinqeyygvpirdqarenqltsynvanakg
rrfaieytvtegdnlkanliig

SCOPe Domain Coordinates for d1y2wa_:

Click to download the PDB-style file with coordinates for d1y2wa_.
(The format of our PDB-style files is described here.)

Timeline for d1y2wa_: