Lineage for d1y2vb_ (1y2v B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 568779Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
    sandwich, 10 strands in 2 sheets;
  4. 568780Superfamily b.97.1: Cytolysin/lectin [63724] (2 families) (S)
    some topological similarity to osmotin
  5. 568796Family b.97.1.2: Fungal fruit body lectin [117119] (2 proteins)
    Pfam 07367
  6. 568801Protein TF antigen-binding lectin [117122] (1 species)
  7. 568802Species Common mushroom (Agaricus bisporus) [TaxId:5341] [117123] (5 PDB entries)
  8. 568810Domain d1y2vb_: 1y2v B: [116412]
    complexed with gal, nga, ser

Details for d1y2vb_

PDB Entry: 1y2v (more details), 1.9 Å

PDB Description: crystal structure of the common edible mushroom (agaricus bisporus) lectin in complex with t-antigen

SCOP Domain Sequences for d1y2vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y2vb_ b.97.1.2 (B:) TF antigen-binding lectin {Common mushroom (Agaricus bisporus)}
tytisirvyqttpkgffrpvertnwkyanggtwdevrgeyvltmggsgtsgslrfvssdt
desfvatfgvhnykrwcdivtnltneqtalvinqeyygvpirdqarenqltsynvanakg
rrfaieytvtegdnlkanliig

SCOP Domain Coordinates for d1y2vb_:

Click to download the PDB-style file with coordinates for d1y2vb_.
(The format of our PDB-style files is described here.)

Timeline for d1y2vb_: