SCOP 1.75: Domain d1y2va_: 1y2v A:

Lineage for d1y2va_ (1y2v A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
   sandwich, 10 strands in 2 sheets;

4. Superfamily b.97.1: Cytolysin/lectin [63724] (2 families)
   some topological similarity to osmotin

5. Family b.97.1.2: Fungal fruit body lectin [117119] (2 proteins)
   Pfam PF07367

6. Protein TF antigen-binding lectin [117122] (1 species)

7. Species Common mushroom (Agaricus bisporus) [TaxId:5341] [117123] (5 PDB entries)
   Uniprot Q00022

8. Domain d1y2va_: 1y2v A: [116411]

Details for d1y2va_

PDB Entry: 1y2v, 1.9 Å

PDB Description: crystal structure of the common edible mushroom (agaricus bisporus) lectin in complex with t-antigen

PDB Compounds: (A:) lectin

SCOP Domain Sequences for d1y2va_:

Sequence; same for both SEQRES and ATOM records:

>d1y2va_ b.97.1.2 (A:) TF antigen-binding lectin {Common mushroom (Agaricus bisporus) [TaxId: 5341]}
tytisirvyqttpkgffrpvertnwkyanggtwdevrgeyvltmggsgtsgslrfvssdt
desfvatfgvhnykrwcdivtnltneqtalvinqeyygvpirdqarenqltsynvanakg
rrfaieytvtegdnlkanliig

Timeline for d1y2va_:

• d1y2va_ first appeared in SCOP 1.71
  
• d1y2va_ appears in SCOP 1.73
  
• d1y2va_ appears in SCOPe 2.01
  
• d1y2va_ appears in the current release, SCOPe 2.08