Lineage for d1y2tb_ (1y2t B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 679150Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
    sandwich, 10 strands in 2 sheets;
  4. 679151Superfamily b.97.1: Cytolysin/lectin [63724] (2 families) (S)
    some topological similarity to osmotin
  5. 679167Family b.97.1.2: Fungal fruit body lectin [117119] (2 proteins)
    Pfam PF07367
  6. 679172Protein TF antigen-binding lectin [117122] (1 species)
  7. 679173Species Common mushroom (Agaricus bisporus) [TaxId:5341] [117123] (5 PDB entries)
  8. 679175Domain d1y2tb_: 1y2t B: [116408]

Details for d1y2tb_

PDB Entry: 1y2t (more details), 1.5 Å

PDB Description: Crystal structure of the common edible mushroom (Agaricus bisporus) lectin
PDB Compounds: (B:) lectin

SCOP Domain Sequences for d1y2tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y2tb_ b.97.1.2 (B:) TF antigen-binding lectin {Common mushroom (Agaricus bisporus) [TaxId: 5341]}
tytisirvyqttpkgffrpvertnwkyanggtwdevrgeyvltmggsgtsgslrfvssdt
desfvatfgvhnykrwcdivtnltneqtalvinqeyygvpirdqarenqltsynvanakg
rrfaieytvtegdnlkanliig

SCOP Domain Coordinates for d1y2tb_:

Click to download the PDB-style file with coordinates for d1y2tb_.
(The format of our PDB-style files is described here.)

Timeline for d1y2tb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1y2ta_