Lineage for d1y2ta_ (1y2t A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2408952Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
    sandwich, 10 strands in 2 sheets;
  4. 2408953Superfamily b.97.1: Cytolysin/lectin [63724] (2 families) (S)
    some topological similarity to osmotin
  5. 2408975Family b.97.1.2: Fungal fruit body lectin [117119] (3 proteins)
    Pfam PF07367
  6. 2408980Protein TF antigen-binding lectin [117122] (1 species)
  7. 2408981Species Common mushroom (Agaricus bisporus) [TaxId:5341] [117123] (5 PDB entries)
    Uniprot Q00022
  8. 2408982Domain d1y2ta_: 1y2t A: [116407]

Details for d1y2ta_

PDB Entry: 1y2t (more details), 1.5 Å

PDB Description: Crystal structure of the common edible mushroom (Agaricus bisporus) lectin
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d1y2ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y2ta_ b.97.1.2 (A:) TF antigen-binding lectin {Common mushroom (Agaricus bisporus) [TaxId: 5341]}
tytisirvyqttpkgffrpvertnwkyanggtwdevrgeyvltmggsgtsgslrfvssdt
desfvatfgvhnykrwcdivtnltneqtalvinqeyygvpirdqarenqltsynvanakg
rrfaieytvtegdnlkanliig

SCOPe Domain Coordinates for d1y2ta_:

Click to download the PDB-style file with coordinates for d1y2ta_.
(The format of our PDB-style files is described here.)

Timeline for d1y2ta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1y2tb_