Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon |
Superfamily d.6.1: Prion-like [54098] (1 family) |
Family d.6.1.1: Prion-like [54099] (3 proteins) |
Protein Prion protein domain [54100] (14 species) |
Species Sheep (Ovis aries) [TaxId:9940] [102729] (6 PDB entries) Uniprot P23907 124-234 ! Uniprot P23907 122-234 ! Uniprot P23907 127-228 |
Domain d1y2sa1: 1y2s A:121-231 [116406] Other proteins in same PDB: d1y2sa2 |
PDB Entry: 1y2s (more details)
SCOPe Domain Sequences for d1y2sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y2sa1 d.6.1.1 (A:121-231) Prion protein domain {Sheep (Ovis aries) [TaxId: 9940]} vvgglggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdrysnqnnfvhdcv nitvkqhtvttttkgenftetdikimervveqmcitqyqresqayyqrgas
Timeline for d1y2sa1: