Lineage for d1y2sa1 (1y2s A:121-231)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175107Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 2175108Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 2175109Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 2175110Protein Prion protein domain [54100] (14 species)
  7. 2175161Species Sheep (Ovis aries) [TaxId:9940] [102729] (6 PDB entries)
    Uniprot P23907 124-234 ! Uniprot P23907 122-234 ! Uniprot P23907 127-228
  8. 2175164Domain d1y2sa1: 1y2s A:121-231 [116406]
    Other proteins in same PDB: d1y2sa2

Details for d1y2sa1

PDB Entry: 1y2s (more details)

PDB Description: ovine prion protein variant r168
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d1y2sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y2sa1 d.6.1.1 (A:121-231) Prion protein domain {Sheep (Ovis aries) [TaxId: 9940]}
vvgglggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdrysnqnnfvhdcv
nitvkqhtvttttkgenftetdikimervveqmcitqyqresqayyqrgas

SCOPe Domain Coordinates for d1y2sa1:

Click to download the PDB-style file with coordinates for d1y2sa1.
(The format of our PDB-style files is described here.)

Timeline for d1y2sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y2sa2