Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.230: Dodecin subunit-like [88797] (5 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
Superfamily d.230.5: YbjQ-like [117782] (1 family) pentamer, beta/alpha-propeller; additional short beta-strands promote oligomeric assembly |
Family d.230.5.1: YbjQ-like [117783] (1 protein) Pfam 01906; DUF 74, UPF0145 |
Protein Hypothetical protein YbjQ [117784] (1 species) |
Species Shigella flexneri [TaxId:623] [117785] (1 PDB entry) |
Domain d1y2ic_: 1y2i C: [116403] |
PDB Entry: 1y2i (more details), 2.3 Å
SCOP Domain Sequences for d1y2ic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y2ic_ d.230.5.1 (C:) Hypothetical protein YbjQ {Shigella flexneri} mqfsttptlegltiveycgvvtgeailganifrdffagirdivggrsgayekelrkarei afeelgsqaralgadavvgididyetvgqngsmlmvsvsgtavktrrni
Timeline for d1y2ic_:
View in 3D Domains from other chains: (mouse over for more information) d1y2ia_, d1y2ib_, d1y2id_, d1y2ie_ |