Lineage for d1y2ic_ (1y2i C:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 616583Fold d.230: Dodecin subunit-like [88797] (5 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 616608Superfamily d.230.5: YbjQ-like [117782] (1 family) (S)
    pentamer, beta/alpha-propeller; additional short beta-strands promote oligomeric assembly
  5. 616609Family d.230.5.1: YbjQ-like [117783] (1 protein)
    Pfam 01906; DUF 74, UPF0145
  6. 616610Protein Hypothetical protein YbjQ [117784] (1 species)
  7. 616611Species Shigella flexneri [TaxId:623] [117785] (1 PDB entry)
  8. 616614Domain d1y2ic_: 1y2i C: [116403]

Details for d1y2ic_

PDB Entry: 1y2i (more details), 2.3 Å

PDB Description: crystal structure of mcsg target apc27401 from shigella flexneri

SCOP Domain Sequences for d1y2ic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y2ic_ d.230.5.1 (C:) Hypothetical protein YbjQ {Shigella flexneri}
mqfsttptlegltiveycgvvtgeailganifrdffagirdivggrsgayekelrkarei
afeelgsqaralgadavvgididyetvgqngsmlmvsvsgtavktrrni

SCOP Domain Coordinates for d1y2ic_:

Click to download the PDB-style file with coordinates for d1y2ic_.
(The format of our PDB-style files is described here.)

Timeline for d1y2ic_: